Anti-PTPN6, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001466
Artikelname: Anti-PTPN6, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001466
Hersteller Artikelnummer: HPA001466
Alternativnummer: ATA-HPA001466-25,ATA-HPA001466-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HCP, HCPH, PTP-1C, SHP-1, SHP1, Pan-Cancer
protein tyrosine phosphatase, non-receptor type 6
Anti-PTPN6
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5777
UniProt: P29350
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTPN6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-PTPN6 antibody. Corresponding PTPN6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA001466
HPA001466
HPA001466