Anti-ZBTB16, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001499
Artikelname: Anti-ZBTB16, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001499
Hersteller Artikelnummer: HPA001499
Alternativnummer: ATA-HPA001499-25,ATA-HPA001499-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PLZF, ZNF145
zinc finger and BTB domain containing 16
Anti-ZBTB16
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 7704
UniProt: Q05516
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ZBTB16
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human adrenal gland shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
Immunohistochemical staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Western blot analysis in human cell line HEL.
HPA001499
HPA001499
HPA001499