Anti-CA2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001550
Artikelname: Anti-CA2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001550
Hersteller Artikelnummer: HPA001550
Alternativnummer: ATA-HPA001550-25,ATA-HPA001550-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CA-II, CAII, Car2
carbonic anhydrase II
Anti-CA2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 760
UniProt: P00918
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and prostate tissues using Anti-CA2 antibody. Corresponding CA2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Western blot analysis in human cell lines HEK293 and PC-3 using Anti-CA2 antibody. Corresponding CA2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA001550
HPA001550
HPA001550