Anti-PON1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001610
| Artikelname: |
Anti-PON1, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA001610 |
| Hersteller Artikelnummer: |
HPA001610 |
| Alternativnummer: |
ATA-HPA001610-25,ATA-HPA001610-100 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ESA, PON, Pan-Cancer |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
5444 |
| UniProt: |
P27169 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
EVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPE |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PON1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
![]()
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
![]()
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue. |
![]()
|
HPA001610 |
![]()
|
HPA001610 |
