Anti-TOM1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001749
Artikelname: Anti-TOM1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001749
Hersteller Artikelnummer: HPA001749
Alternativnummer: ATA-HPA001749-25,ATA-HPA001749-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TOM1
target of myb1 (chicken)
Anti-TOM1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10043
UniProt: O60784
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TOM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-21
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA001749
HPA001749
HPA001749