Anti-APOBEC3G, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001812
- Bilder (9)
| Artikelname: | Anti-APOBEC3G, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA001812 |
| Hersteller Artikelnummer: | HPA001812 |
| Alternativnummer: | ATA-HPA001812-25,ATA-HPA001812-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019 |
| apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G |
| Anti-APOBEC3G |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 60489 |
| UniProt: | Q9HC16 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APOBEC3G |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA001812 antibody. Corresponding APOBEC3G RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA001812 |
|
|
HPA001812 |
|
|
HPA001812 |
Produktgarantie und fachkundiger Support
