Anti-VWF, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001815
Artikelname: Anti-VWF, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001815
Hersteller Artikelnummer: HPA001815
Alternativnummer: ATA-HPA001815-25,ATA-HPA001815-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: F8VWF, Pan-Cancer
von Willebrand factor
Anti-VWF
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 7450
UniProt: P04275
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: VWF
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human esophagus shows vessel positivity in squamous epithelial cells.
HPA001815