Anti-CHEK2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001878
Artikelname: Anti-CHEK2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001878
Hersteller Artikelnummer: HPA001878
Alternativnummer: ATA-HPA001878-100,ATA-HPA001878-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bA444G7, CDS1, CHK2, HuCds1, PP1425, RAD53, Pan-Cancer
checkpoint kinase 2
Anti-CHEK2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 11200
UniProt: O96017
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CHEK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and CHEK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416128).
HPA001878
HPA001878
HPA001878