Anti-SOX6, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001923
Artikelname: Anti-SOX6, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001923
Hersteller Artikelnummer: HPA001923
Alternativnummer: ATA-HPA001923-25,ATA-HPA001923-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SOX6
SRY (sex determining region Y)-box 6
Anti-SOX6
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 55553
UniProt: P35712
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SOX6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts, as well as weak positivity in Leydig cells.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
HPA001923
HPA001923
HPA001923