Anti-CD14, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002127
Artikelname: Anti-CD14, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002127
Hersteller Artikelnummer: HPA002127
Alternativnummer: ATA-HPA002127-25,ATA-HPA002127-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
CD14 molecule
Anti-CD14
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 929
UniProt: P08571
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD14
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA002127 antibody. Corresponding CD14 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver, lymph node, pancreas and rectum using Anti-CD14 antibody HPA002127 (A) shows similar protein distribution across tissues to independent antibody HPA001887 (B).
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human lymph node shows moderate to strong membranous positivity in lymphoid cells.
Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatic sinusoid cells.
Western blot analysis using Anti-CD14 antibody HPA002127 (A) shows similar pattern to independent antibody HPA001887 (B).
HPA002127
HPA002127
HPA002127