Anti-CD14, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA002127
- Bilder (11)
Artikelname: | Anti-CD14, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA002127 |
Hersteller Artikelnummer: | HPA002127 |
Alternativnummer: | ATA-HPA002127-25,ATA-HPA002127-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | IHC, WB |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | Pan-Cancer |
CD14 molecule |
Anti-CD14 |
Klonalität: | Polyclonal |
Konzentration: | 0.4 mg/ml |
Isotyp: | IgG |
NCBI: | 929 |
UniProt: | P08571 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | CD14 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |