Anti-CD55, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA002190
- Bilder (10)
| Artikelname: | Anti-CD55, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA002190 |
| Hersteller Artikelnummer: | HPA002190 |
| Alternativnummer: | ATA-HPA002190-25,ATA-HPA002190-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CR, CROM, DAF, TC, Pan-Cancer |
| CD55 molecule, decay accelerating factor for complement (Cromer blood group) |
| Anti-CD55 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1604 |
| UniProt: | P08174 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD55 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lung and pancreas tissues using HPA002190 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human cell line HeLa. |
|
|
HPA002190 |
|
|
HPA002190 |
|
|
HPA002190 |
Produktgarantie und fachkundiger Support
