Anti-GOLIM4, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002315
Artikelname: Anti-GOLIM4, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002315
Hersteller Artikelnummer: HPA002315
Alternativnummer: ATA-HPA002315-25,ATA-HPA002315-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GIMPC, GOLPH4, GPP130, P138
golgi integral membrane protein 4
Anti-GOLIM4
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 27333
UniProt: O00461
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GOLIM4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human small intestine and skin tissues using Anti-GOLIM4 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody HPA002315 (A) shows similar protein distribution across tissues to independent antibody HPA001677 (B).
Immunohistochemical staining of human skin shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human cerebral cortex using Anti-GOLIM4 antibody HPA002315.
Immunohistochemical staining of human liver using Anti-GOLIM4 antibody HPA002315.
HPA002315
HPA002315
HPA002315