Anti-KRT19, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002465
Artikelname: Anti-KRT19, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002465
Hersteller Artikelnummer: HPA002465
Alternativnummer: ATA-HPA002465-25,ATA-HPA002465-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CK19, K19, K1CS, MGC15366, Pan-Cancer
keratin 19
Anti-KRT19
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3880
UniProt: P08727
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KRT19
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line MCF7 shows localization to intermediate filaments.
Immunohistochemistry analysis in human urinary bladder and lymph node tissues using HPA002465 antibody. Corresponding KRT19 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human urinary bladder shows strong cytoplasmic/membranous positivity in urothelial cells.
Immunohistochemical staining of human small intestine shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemical staining of human breast shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemical staining of human lymph node shows no positivity as expected.
HPA002465
HPA002465
HPA002465