Anti-AURKA, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002636
Artikelname: Anti-AURKA, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002636
Hersteller Artikelnummer: HPA002636
Alternativnummer: ATA-HPA002636-25,ATA-HPA002636-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7, Pan-Cancer
aurora kinase A
Anti-AURKA
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 6790
UniProt: O14965
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AURKA
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus, cytosol & centrosome.
Immunohistochemical staining of human testis shows moderate positivity in a subset of cells in seminiferous ducts.
Western blot analysis in human cell line SK-BR-3.
HPA002636
HPA002636
HPA002636