Anti-SELP, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002655
Artikelname: Anti-SELP, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002655
Hersteller Artikelnummer: HPA002655
Alternativnummer: ATA-HPA002655-25,ATA-HPA002655-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD62, CD62P, GMP140, GRMP, PADGEM, PSEL, Pan-Cancer
selectin P (granule membrane protein 140kDa, antigen CD62)
Anti-SELP
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 6403
UniProt: P16109
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SELP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human bone marrow shows strong positivity in megakaryocytes.
Western blot analysis in control (vector only transfected HEK293T lysate) and SELP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418960).
HPA002655
HPA002655