Anti-LCN2, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA002695
- Bilder (8)
| Artikelname: | Anti-LCN2, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA002695 |
| Hersteller Artikelnummer: | HPA002695 |
| Alternativnummer: | ATA-HPA002695-25,ATA-HPA002695-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 24p3, NGAL, Pan-Cancer |
| lipocalin 2 |
| Anti-LCN2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3934 |
| UniProt: | P80188 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LCN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-LCN2 antibody. Corresponding LCN2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Western blot analysis in Capan-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-LCN2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA002695 |
|
|
|
|
|
HPA002695 |
|
|
HPA002695 |
Produktgarantie und fachkundiger Support
