Anti-CFAP57, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002736
Artikelname: Anti-CFAP57, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002736
Hersteller Artikelnummer: HPA002736
Alternativnummer: ATA-HPA002736-25,ATA-HPA002736-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ32000, WDR65
cilia and flagella associated protein 57
Anti-CFAP57
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 149465
UniProt: Q96MR6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CFAP57
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP57 antibody. Corresponding CFAP57 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube, liver, lymph node and prostate using Anti-CFAP57 antibody HPA002736 (A) shows similar protein distribution across tissues to independent antibody HPA028623 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human liver using Anti-CFAP57 antibody HPA002736.
Immunohistochemical staining of human lymph node using Anti-CFAP57 antibody HPA002736.
HPA002736
HPA002736
HPA002736