Anti-SLC6A14, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003193
Artikelname: Anti-SLC6A14, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003193
Hersteller Artikelnummer: HPA003193
Alternativnummer: ATA-HPA003193-25,ATA-HPA003193-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SLC6A14
solute carrier family 6 (amino acid transporter), member 14
Anti-SLC6A14
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 11254
UniProt: Q9UN76
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC6A14
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry analysis in human lung and liver tissues using HPA003193 antibody. Corresponding SLC6A14 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected.
Immunohistochemical staining of human lung shows strong membranous positivity in macrophages.
HPA003193
HPA003193
HPA003193