Anti-OLIG2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003254
Artikelname: Anti-OLIG2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003254
Hersteller Artikelnummer: HPA003254
Alternativnummer: ATA-HPA003254-25,ATA-HPA003254-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BHLHB1, bHLHe19, OLIGO2, PRKCBP2, RACK17
oligodendrocyte lineage transcription factor 2
Anti-OLIG2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 10215
UniProt: Q13516
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: OLIG2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA003254 antibody. Corresponding OLIG2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in oligodendrocytes.
Immunohistochemical staining of human liver shows no positivity as expected.
Western blot analysis in human cerebral cortex tissue.
HPA003254
HPA003254
HPA003254