Anti-DCN, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003315
Artikelname: Anti-DCN, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003315
Hersteller Artikelnummer: HPA003315
Alternativnummer: ATA-HPA003315-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DSPG2, SLRR1B
decorin
Anti-DCN
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1634
UniProt: P07585
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DCN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human ovary and cerebral cortex tissues using Anti-DCN antibody. Corresponding DCN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human ovary shows high expression.
Western blot analysis in human cell line U-2197.
Western blot analysis in control (vector only transfected HEK293T lysate) and DCN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403339).
HPA003315
HPA003315
HPA003315