Anti-SH3KBP1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA003351
- Bilder (9)
Artikelname: | Anti-SH3KBP1, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA003351 |
Hersteller Artikelnummer: | HPA003351 |
Alternativnummer: | ATA-HPA003351-25,ATA-HPA003351-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | IHC, WB |
Spezies Reaktivität: | Human, Mouse |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | CIN85 |
SH3-domain kinase binding protein 1 |
Anti-SH3KBP1 |
Klonalität: | Polyclonal |
Konzentration: | 0.1 mg/ml |
Isotyp: | IgG |
NCBI: | 30011 |
UniProt: | Q96B97 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | GDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLP |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | SH3KBP1 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |