Anti-RPLP0, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003512
Artikelname: Anti-RPLP0, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003512
Hersteller Artikelnummer: HPA003512
Alternativnummer: ATA-HPA003512-25,ATA-HPA003512-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: L10E, LP0, P0, PRLP0, RPP0
ribosomal protein, large, P0
Anti-RPLP0
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 6175
UniProt: P05388
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RPLP0
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA003512
HPA003512
HPA003512