Anti-FCGBP, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA003564
- Bilder (9)
| Artikelname: | Anti-FCGBP, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA003564 |
| Hersteller Artikelnummer: | HPA003564 |
| Alternativnummer: | ATA-HPA003564-25,ATA-HPA003564-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FC(GAMMA)BP |
| Fc fragment of IgG binding protein |
| Anti-FCGBP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8857 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FCGBP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human colon and liver tissues using Anti-FCGBP antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-FCGBP antibody HPA003564 (A) shows similar protein distribution across tissues to independent antibody HPA003517 (B). |
|
|
Immunohistochemical staining of human colon shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-FCGBP antibody HPA003564. |
|
|
Immunohistochemical staining of human kidney using Anti-FCGBP antibody HPA003564. |
|
|
HPA003564 |
|
|
HPA003564 |
|
|
HPA003564 |
Produktgarantie und fachkundiger Support
