Anti-TRIM22, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003575
Artikelname: Anti-TRIM22, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003575
Hersteller Artikelnummer: HPA003575
Alternativnummer: ATA-HPA003575-25,ATA-HPA003575-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GPSTAF50, RNF94, STAF50
tripartite motif containing 22
Anti-TRIM22
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 10346
UniProt: Q8IYM9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRIM22
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line ASC TERT1 shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus.
Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TRIM22 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
HPA003575
HPA003575
HPA003575