Anti-FAM50A, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA003585
- Bilder (9)
| Artikelname: | Anti-FAM50A, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA003585 |
| Hersteller Artikelnummer: | HPA003585 |
| Alternativnummer: | ATA-HPA003585-25,ATA-HPA003585-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 9F, DXS9928E, HXC-26, XAP5 |
| family with sequence similarity 50, member A |
| Anti-FAM50A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9130 |
| UniProt: | Q14320 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM50A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-FAM50A antibody. Remaining relative intensity is presented. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA003585 |
|
|
|
|
|
|
|
|
HPA003585 |
|
|
HPA003585 |
Produktgarantie und fachkundiger Support
