Anti-MUC1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004179
Artikelname: Anti-MUC1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004179
Hersteller Artikelnummer: HPA004179
Alternativnummer: ATA-HPA004179-25,ATA-HPA004179-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ADMCKD, ADMCKD1, CD227, MCD, MCKD, MCKD1, PEM, PUM, Pan-Cancer
mucin 1, cell surface associated
Anti-MUC1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4582
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ASSTPGGEKETSATQRSSVPSSTEKVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MUC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human stomach and liver tissues using HPA004179 antibody. Corresponding MUC1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules.
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA004179
HPA004179
HPA004179