Anti-LRP1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA004182
Artikelname: |
Anti-LRP1, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA004182 |
Hersteller Artikelnummer: |
HPA004182 |
Alternativnummer: |
ATA-HPA004182-25,ATA-HPA004182-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
A2MR, APOER, APR, CD91, LRP, LRP1A, Pan-Cancer |
low density lipoprotein receptor-related protein 1 |
Klonalität: |
Polyclonal |
Isotyp: |
IgG |
NCBI: |
4035 |
UniProt: |
Q07954 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
LRP1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & vesicles. |
|
Immunohistochemical staining of human hippocampus shows mdrate cytoplasmic positivity in neuronal cells. |
|
HPA004182 |
|
|
|
HPA004182 |
|
HPA004182 |