Anti-LRP1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004182
Artikelname: Anti-LRP1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004182
Hersteller Artikelnummer: HPA004182
Alternativnummer: ATA-HPA004182-25,ATA-HPA004182-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: A2MR, APOER, APR, CD91, LRP, LRP1A, Pan-Cancer
low density lipoprotein receptor-related protein 1
Anti-LRP1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 4035
UniProt: Q07954
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LRP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & vesicles.
Immunohistochemical staining of human hippocampus shows mdrate cytoplasmic positivity in neuronal cells.
HPA004182
HPA004182
HPA004182