Anti-TRIM33, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA004345
- Bilder (9)
| Artikelname: | Anti-TRIM33, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA004345 |
| Hersteller Artikelnummer: | HPA004345 |
| Alternativnummer: | ATA-HPA004345-25,ATA-HPA004345-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ11429, KIAA1113, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA |
| tripartite motif containing 33 |
| Anti-TRIM33 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51592 |
| UniProt: | Q9UPN9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TRIM33 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human hippocampus shows strong nuclear positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-TRIM33 antibody. Corresponding TRIM33 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA004345 |
|
|
|
|
|
|
|
|
HPA004345 |
|
|
HPA004345 |
Produktgarantie und fachkundiger Support
