Anti-KIT, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004471
Artikelname: Anti-KIT, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004471
Hersteller Artikelnummer: HPA004471
Alternativnummer: ATA-HPA004471-25,ATA-HPA004471-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C-Kit, CD117, PBT, SCFR, Pan-Cancer
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Anti-KIT
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3815
UniProt: P10721
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human breast and prostate tissues using Anti-KIT antibody. Corresponding KIT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human breast shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA004471
HPA004471
HPA004471