Anti-KIT, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA004471
- Bilder (6)
Artikelname: | Anti-KIT, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA004471 |
Hersteller Artikelnummer: | HPA004471 |
Alternativnummer: | ATA-HPA004471-25,ATA-HPA004471-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | IHC |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | C-Kit, CD117, PBT, SCFR, Pan-Cancer |
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog |
Anti-KIT |
Klonalität: | Polyclonal |
Konzentration: | 0.2 mg/ml |
Isotyp: | IgG |
NCBI: | 3815 |
UniProt: | P10721 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | KIT |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:50 - 1:200 |