Anti-PGR, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA004751
- Bilder (9)
| Artikelname: | Anti-PGR, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA004751 |
| Hersteller Artikelnummer: | HPA004751 |
| Alternativnummer: | ATA-HPA004751-25,ATA-HPA004751-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NR3C3, PR, Pan-Cancer |
| progesterone receptor |
| Anti-PGR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5241 |
| UniProt: | P06401 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PGR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human endometrium and testis tissues using Anti-PGR antibody. Corresponding PGR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA004751 (A) shows similar protein distribution across tissues to independent antibody HPA008428 (B). |
|
|
Immunohistochemical staining of human endometrium shows high expression. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA004751. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA004751. |
|
|
HPA004751 |
|
|
HPA004751 |
|
|
HPA004751 |
Produktgarantie und fachkundiger Support
