Anti-FOSL2, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA004817
- Bilder (9)
| Artikelname: | Anti-FOSL2, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA004817 |
| Hersteller Artikelnummer: | HPA004817 |
| Alternativnummer: | ATA-HPA004817-25,ATA-HPA004817-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ23306, FRA2 |
| FOS-like antigen 2 |
| Anti-FOSL2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2355 |
| UniProt: | P15408 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FOSL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells. |
|
|
Western blot analysis in human cell lines U2OS and HEK293 using Anti-FOSL2 antibody. Corresponding FOSL2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA004817 |
|
|
|
|
|
|
|
|
HPA004817 |
|
|
HPA004817 |
Produktgarantie und fachkundiger Support
