Anti-SUGP1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004890
Artikelname: Anti-SUGP1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004890
Hersteller Artikelnummer: HPA004890
Alternativnummer: ATA-HPA004890-25,ATA-HPA004890-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp434E2216, F23858, RBP, SF4
SURP and G patch domain containing 1
Anti-SUGP1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 57794
UniProt: Q8IWZ8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SUGP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SUGP1 antibody. Remaining relative intensity is presented.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA004890
HPA004890
HPA004890