Anti-BCL6, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004899
Artikelname: Anti-BCL6, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004899
Hersteller Artikelnummer: HPA004899
Alternativnummer: ATA-HPA004899-25,ATA-HPA004899-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
B-cell CLL/lymphoma 6
Anti-BCL6
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 604
UniProt: P41182
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARPYFPCDKASKEEERPSSEDEIALHFEPPPLNRKGLVSPQSPQKSDCQPNSPTESCSSKCILQASGSPPAKSPTDPKACNWKKYKFIVLNS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BCL6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA004899 antibody. Corresponding BCL6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human pancreas shows no positivity as expected.
HPA004899
HPA004899
HPA004899