Anti-HPGD, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004919
Artikelname: Anti-HPGD, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004919
Hersteller Artikelnummer: HPA004919
Alternativnummer: ATA-HPA004919-25,ATA-HPA004919-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SDR36C1
hydroxyprostaglandin dehydrogenase 15-(NAD)
Anti-HPGD
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3248
UniProt: P15428
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HPGD
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human urinary bladder and skeletal muscle tissues using Anti-HPGD antibody. Corresponding HPGD RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human urinary bladder shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Western blot analysis using Anti-HPGD antibody HPA004919 (A) shows similar pattern to independent antibody HPA005679 (B).
HPA004919
HPA004919
HPA004919