Anti-SEC31A, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005457
Artikelname: Anti-SEC31A, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005457
Hersteller Artikelnummer: HPA005457
Alternativnummer: ATA-HPA005457-25,ATA-HPA005457-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ABP125, ABP130, KIAA0905, SEC31L1
SEC31 homolog A (S. cerevisiae)
Anti-SEC31A
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 22872
UniProt: O94979
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SEC31A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles.
Immunohistochemical staining of human endometrium shows positivit in glandular cells.
Immunohistochemical staining of human cerebral cortex shows positivity in neurons.
Immunohistochemical staining of human liver shows positivity in hepatocytes.
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
HPA005457
HPA005457
HPA005457