Anti-SEC31A, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA005457
Artikelname: |
Anti-SEC31A, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA005457 |
Hersteller Artikelnummer: |
HPA005457 |
Alternativnummer: |
ATA-HPA005457-25,ATA-HPA005457-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
ABP125, ABP130, KIAA0905, SEC31L1 |
SEC31 homolog A (S. cerevisiae) |
Klonalität: |
Polyclonal |
Konzentration: |
0.2 mg/ml |
Isotyp: |
IgG |
NCBI: |
22872 |
UniProt: |
O94979 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
SEC31A |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles. |
|
Immunohistochemical staining of human endometrium shows positivit in glandular cells. |
|
Immunohistochemical staining of human cerebral cortex shows positivity in neurons. |
|
Immunohistochemical staining of human liver shows positivity in hepatocytes. |
|
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes. |
|
HPA005457 |
|
|
|
HPA005457 |
|
HPA005457 |