Anti-SNCA, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA005459
- Bilder (9)
| Artikelname: | Anti-SNCA, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA005459 |
| Hersteller Artikelnummer: | HPA005459 |
| Alternativnummer: | ATA-HPA005459-25,ATA-HPA005459-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | alpha-synuclein, NACP, PARK1, PARK4, PD1 |
| synuclein, alpha (non A4 component of amyloid precursor) |
| Anti-SNCA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6622 |
| UniProt: | P37840 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SNCA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-SNCA antibody. Corresponding SNCA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-SNCA antibody. Corresponding SNCA RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 |
|
|
HPA005459 |
|
|
|
|
|
HPA005459 |
|
|
HPA005459 |
Produktgarantie und fachkundiger Support
