Anti-ASAH1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005468
Artikelname: Anti-ASAH1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005468
Hersteller Artikelnummer: HPA005468
Alternativnummer: ATA-HPA005468-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AC, ASAH, FLJ21558, PHP32
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Anti-ASAH1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 427
UniProt: Q13510
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ASAH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
HPA005468
HPA005468
HPA005468