Anti-ANXA10, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005469
Artikelname: Anti-ANXA10, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005469
Hersteller Artikelnummer: HPA005469
Alternativnummer: ATA-HPA005469-25,ATA-HPA005469-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ANX14
annexin A10
Anti-ANXA10
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 11199
UniProt: Q9UJ72
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ANXA10
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and tonsil tissues using HPA005469 antibody. Corresponding ANXA10 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
Immunohistochemical staining of human tonsil shows no positivity as expected.
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Western blot analysis in human stomach tissue.
HPA005469
HPA005469
HPA005469