Anti-KEAP1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA005558
Artikelname: |
Anti-KEAP1, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA005558 |
Hersteller Artikelnummer: |
HPA005558 |
Alternativnummer: |
ATA-HPA005558-25,ATA-HPA005558-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454 |
kelch-like ECH-associated protein 1 |
Klonalität: |
Polyclonal |
Isotyp: |
IgG |
NCBI: |
9817 |
UniProt: |
Q14145 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
KEAP1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. |
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes. |
|
HPA005558 |
|
|
|
HPA005558 |
|
HPA005558 |