Anti-CASP8, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA005688
| Artikelname: |
Anti-CASP8, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA005688 |
| Hersteller Artikelnummer: |
HPA005688 |
| Alternativnummer: |
ATA-HPA005688-25,ATA-HPA005688-100 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Casp-8, FLICE, MACH, MCH5, Pan-Cancer |
| caspase 8, apoptosis-related cysteine peptidase |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
841 |
| UniProt: |
Q14790 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
CASP8 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
![]()
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells. |
![]()
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4 |
![]()
|
HPA005688 |
![]()
|
HPA005688 |
