Anti-PDZK1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA005755
- Bilder (9)
| Artikelname: | Anti-PDZK1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA005755 |
| Hersteller Artikelnummer: | HPA005755 |
| Alternativnummer: | ATA-HPA005755-25,ATA-HPA005755-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NHERF3, PDZD1 |
| PDZ domain containing 1 |
| Anti-PDZK1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5174 |
| UniProt: | Q5T2W1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVET |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PDZK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-PDZK1 antibody. Corresponding PDZK1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Western blot analysis in human cell line TD47D. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and PDZK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400926). |
|
|
HPA005755 |
|
|
|
|
|
HPA005755 |
|
|
HPA005755 |
Produktgarantie und fachkundiger Support
