Anti-PCP4, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005792
Artikelname: Anti-PCP4, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005792
Hersteller Artikelnummer: HPA005792
Alternativnummer: ATA-HPA005792-25,ATA-HPA005792-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PEP-19
Purkinje cell protein 4
Anti-PCP4
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5121
UniProt: P48539
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PCP4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005792 antibody. Corresponding PCP4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity.
Immunofluorescence staining of mouse cerebral cortex shows strong positivity in the deep layers neurons.
Immunofluorescence staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells.
HPA005792
HPA005792
HPA005792