Anti-GRHL1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA005798
- Bilder (9)
| Artikelname: | Anti-GRHL1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA005798 |
| Hersteller Artikelnummer: | HPA005798 |
| Alternativnummer: | ATA-HPA005798-25,ATA-HPA005798-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LBP-32, MGR, TFCP2L2 |
| grainyhead-like 1 (Drosophila) |
| Anti-GRHL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29841 |
| UniProt: | Q9NZI5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GRHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus. |
|
|
Immunohistochemical staining of human esophagus shows strong nuclear positivity in squamous epithelial cells. |
|
|
Western blot analysis in human cell line BEWO. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA005798 |
|
|
|
|
|
|
|
|
HPA005798 |
|
|
HPA005798 |
Produktgarantie und fachkundiger Support
