Anti-CLIC3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005963
Artikelname: Anti-CLIC3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005963
Hersteller Artikelnummer: HPA005963
Alternativnummer: ATA-HPA005963-25,ATA-HPA005963-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLIC3
chloride intracellular channel 3
Anti-CLIC3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9022
UniProt: O95833
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CLIC3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and A-549 using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line MCF-7
HPA005963
HPA005963