Anti-HMBS, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA006114
- Bilder (9)
| Artikelname: | Anti-HMBS, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA006114 |
| Hersteller Artikelnummer: | HPA006114 |
| Alternativnummer: | ATA-HPA006114-25,ATA-HPA006114-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PBGD, PORC, UPS |
| hydroxymethylbilane synthase |
| Anti-HMBS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3145 |
| UniProt: | P08397 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HMBS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA006114 |
|
|
|
|
|
HPA006114 |
|
|
HPA006114 |
Produktgarantie und fachkundiger Support
