Anti-TP63, Rabbit, Polyclonal

Artikelnummer: ATA-HPA006288
Artikelname: Anti-TP63, Rabbit, Polyclonal
Artikelnummer: ATA-HPA006288
Hersteller Artikelnummer: HPA006288
Alternativnummer: ATA-HPA006288-25,ATA-HPA006288-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L, Pan-Cancer
tumor protein p63
Anti-TP63
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 8626
UniProt: Q9H3D4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TP63
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skin and duodenum tissues using Anti-TP63 antibody. Corresponding TP63 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human duodenum shows low expression as expected.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006288
HPA006288
HPA006288