Anti-SIRT1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA006295
- Bilder (9)
Artikelname: | Anti-SIRT1, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA006295 |
Hersteller Artikelnummer: | HPA006295 |
Alternativnummer: | ATA-HPA006295-25,ATA-HPA006295-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | ICC, IHC |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | SIR2L1 |
sirtuin 1 |
Anti-SIRT1 |
Klonalität: | Polyclonal |
Konzentration: | 0.2 mg/ml |
Isotyp: | IgG |
NCBI: | 23411 |
UniProt: | Q96EB6 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | SIRT1 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |