Anti-CCT3, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA006543
- Bilder (9)
| Artikelname: | Anti-CCT3, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA006543 |
| Hersteller Artikelnummer: | HPA006543 |
| Alternativnummer: | ATA-HPA006543-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Cctg, TRIC5 |
| chaperonin containing TCP1, subunit 3 (gamma) |
| Anti-CCT3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7203 |
| UniProt: | P49368 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCT3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCT3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA006543 |
|
|
|
|
|
|
|
|
HPA006543 |
|
|
HPA006543 |
Produktgarantie und fachkundiger Support
