Anti-RBM14, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA006628
- Bilder (9)
| Artikelname: | Anti-RBM14, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA006628 |
| Hersteller Artikelnummer: | HPA006628 |
| Alternativnummer: | ATA-HPA006628-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COAA, DKFZp779J0927, SIP, SYTIP1 |
| RNA binding motif protein 14 |
| Anti-RBM14 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10432 |
| UniProt: | Q96PK6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TQSSASLAASYAAQQHPQAAASYRGQPGYDGAGQPSAAYLSMSQGAVANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RBM14 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in both neuronal cells and glial cells. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA006628 |
|
|
|
|
|
|
|
|
HPA006628 |
|
|
HPA006628 |
Produktgarantie und fachkundiger Support
