Anti-TP63, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007010
Artikelname: Anti-TP63, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007010
Hersteller Artikelnummer: HPA007010
Alternativnummer: ATA-HPA007010-25,ATA-HPA007010-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L, Pan-Cancer
tumor protein p63
Anti-TP63
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 8626
UniProt: Q9H3D4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TP63
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry analysis in human skin and pancreas tissues using HPA007010 antibody. Corresponding TP63 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows weak nuclear positivity in basal layer of glandular cells.
Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human skin shows strong nuclear positivity in keratinocytes.
HPA007010
HPA007010
HPA007010